Men's Rope Two-Tone Band Rings - NM22 - Roselle Jewelry

NM22 - Men's Vintage Rope Two-Tone Gold Wedding Band Ring

$4,188.00 HKD
In Stock Pre order Out of stock

Braided Color: White Gold + Yellow Gold

White Gold + Yellow Gold
White Gold + Rose Gold
Yellow Gold + Rose Gold
White Gold Only
Yellow Gold Only
Rose Gold Only

Metal: S925 Silver (Platinum Plated)

S925 Silver (Platinum Plated)
9K Gold
14K Gold
18K Gold
Walk-ins welcome · No appointment needed
Visit our Hong Kong stores to view diamonds and custom pieces, or WhatsApp us for a quick quote.
For rings, one-time resize within ±2 sizes is included after purchase.

Embrace the timeless elegance of the NM22 Men's Rope Wedding Band from Roselle Jewelry. This ring refines the classic rope motif with a touch of vintage sophistication. Featuring a central twisted rope design flanked by contrasting gold rails, the NM22 often incorporates subtle detailing like milgrain (beaded) edges or step profiles that frame the twist like a work of art. The two-tone combination highlights the intricate texture, symbolizing the weaving together of two unique stories into a harmonious whole. It is a ring that speaks of enduring love, patience, and a bond that grows more beautiful with time. Handcrafted in 18K gold.

Product Code NM22
Width(mm) 6.0
Size HK#10 ~ HK#30

american expressapple paygoogle payvisamasterunionpaypaypalfpspaymealipaywechatpayalipay hkshopify paydiscoverdiners club

Product questions

Is the centre stone included?
For products marked “Setting Only”, the centre stone is not included. For finished jewellery, the stone shown in your selected option is included unless the product page states otherwise.
How do I choose the correct ring size?
Use our ring size guide and measure at a comfortable room temperature. For wide bands or unusual designs, contact us before ordering.
Can the ring be resized after purchase?
Many rings can be resized, but the available range depends on the design, metal and stone setting. Full-eternity and certain intricate designs may not be resizable.
Which metals are available?
Available metals and colours are listed in the product selector. The final price updates according to the selected metal and other paid options.
Is a diamond certificate included?
A grading report is included only when it is explicitly stated in the product description or selected option. Please contact us if you require a specific laboratory report.
Are customised or engraved items returnable?
Customised, resized, engraved and made-to-order items may have different exchange or refund conditions. Review the policy before confirming your order.