Men's Rope Two-Tone Band Rings - NM22 - Roselle Jewelry

NM22 - Bague de mariage vintage pour homme en or bicolore à motif corde

$4,188.00 HKD
En stock Pré-commande En rupture de stock

Couleur tressée: Or blanc + Or jaune

Or blanc + Or jaune
Or blanc + Or rose
Or jaune + Or rose
Or blanc uniquement
Or jaune uniquement
Or rose uniquement

Métal: Argent S925 (plaqué platine)

Argent S925 (plaqué platine)
Or 9K
Or 14K
Or 18K
Walk-ins welcome · No appointment needed
Visit our Hong Kong stores to view diamonds and custom pieces, or WhatsApp us for a quick quote.
For rings, one-time resize within ±2 sizes is included after purchase.

Adoptez l'élégance intemporelle de la bague de mariage en corde pour homme NM22 de Roselle Jewelry. Cette bague affine le motif classique de la corde avec une touche de sophistication vintage. Dotée d'un design central en corde torsadée encadré par des rails en or contrastants, la NM22 intègre souvent des détails subtils comme des bords milgrain (perlés) ou des profils en escalier qui encadrent la torsade comme une œuvre d'art. La combinaison bicolore met en valeur la texture complexe, symbolisant l'entrelacement de deux histoires uniques en un tout harmonieux. C'est une bague qui parle d'amour durable, de patience et d'un lien qui devient plus beau avec le temps. Faite à la main en or 18K.

Code produit NM22
Largeur (mm) 6.0
Taille HK#10 ~ HK#30

american expressapple paygoogle payvisamasterunionpaypaypalfpspaymealipaywechatpayalipay hkshopify paydiscoverdiners club

Product questions

Is the centre stone included?
For products marked “Setting Only”, the centre stone is not included. For finished jewellery, the stone shown in your selected option is included unless the product page states otherwise.
How do I choose the correct ring size?
Use our ring size guide and measure at a comfortable room temperature. For wide bands or unusual designs, contact us before ordering.
Can the ring be resized after purchase?
Many rings can be resized, but the available range depends on the design, metal and stone setting. Full-eternity and certain intricate designs may not be resizable.
Which metals are available?
Available metals and colours are listed in the product selector. The final price updates according to the selected metal and other paid options.
Is a diamond certificate included?
A grading report is included only when it is explicitly stated in the product description or selected option. Please contact us if you require a specific laboratory report.
Are customised or engraved items returnable?
Customised, resized, engraved and made-to-order items may have different exchange or refund conditions. Review the policy before confirming your order.