Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry
Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry
Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry
Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry
Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry
Cat Pattern Dancing Stone Pendants - CD13 - Roselle Jewelry

Pendentifs Pierre Dansante Motif Chat - CD13

$888.00 HKD
En stock Pré-commande En rupture de stock

Métal: Argent S925 (plaqué platine)

Argent S925 (plaqué platine)
Or blanc 9K
Or jaune 9K
Or rose 9K
18K Or Blanc
18K Or Jaune
18K Or rose
PT950 Platine
Ajouter à WishListComparer
Walk-ins welcome · No appointment needed
Visit our Hong Kong stores to view diamonds and custom pieces, or WhatsApp us for a quick quote.
For rings, one-time resize within ±2 sizes is included after purchase.
Code produit CD13
Pierre principale RZ®Diamant simulé
Forme Taille brillant rond
Couleur de la pierre principale Transparent (D)
Principal Poids de la pierre (ct) 0.50
Pureté Sans défaut (FL)
Taille Excellent
Largeur (mm) 9.5
GLongueur(mm) 9.6

american expressapple paygoogle payvisamasterunionpaypaypalfpspaymealipaywechatpayalipay hkshopify paydiscoverdiners club