Men's Rope Two-Tone Band Rings - NM22 - Roselle Jewelry

NM22 - Vintage na Sinturon ng Panlalaking Dalawang-Tono na Gintong Singsing ng Kasal

$4,188.00 HKD
In Stock Pre order Wala nang stock

Pinagsamang Kulay: Puting Ginto + Dilaw na Ginto

Puting Ginto + Dilaw na Ginto
Puting Ginto + Rosas na Ginto
Dilaw na Ginto + Rosas na Ginto
Puting Ginto Lamang
Dilaw na Ginto Lamang
Rosas na Ginto Lamang

Metal: S925 Pilak (Pinahiran ng Platinum)

S925 Pilak (Pinahiran ng Platinum)
9K Ginto
14K Ginto
18K Ginto
Add to WishlistCompare
Walk-ins welcome · No appointment needed
Visit our Hong Kong stores to view diamonds and custom pieces, or WhatsApp us for a quick quote.
For rings, one-time resize within ±2 sizes is included after purchase.

Yakapin ang walang hanggang kagandahan ng NM22 Men's Rope Wedding Band mula sa Roselle Jewelry. Pinapaganda ng singsing na ito ang klasikong rope motif na may halong vintage na sopistikasyon. Tampok ang gitnang twisted rope design na may kasamang magkasalungat na gintong riles, madalas na may mga banayad na detalye tulad ng milgrain (beaded) na mga gilid o step profiles na bumabalot sa twist na parang isang likhang sining. Ang kombinasyon ng dalawang tono ay nagpapatingkad sa masalimuot na texture, na sumasagisag sa pagsasama ng dalawang natatanging kwento sa isang harmoniyosong kabuuan. Ito ay isang singsing na nagsasalita ng matibay na pag-ibig, pagtitiis, at isang ugnayan na lalo pang gumaganda sa paglipas ng panahon. Ginawa nang kamay sa 18K ginto.

Kode ng Produkto NM22
Lapad (mm) 6.0
Sukat HK#10 ~ HK#30

american expressapple paygoogle payvisamasterunionpaypaypalfpspaymealipaywechatpayalipay hkshopify paydiscoverdiners club

Product questions

Is the centre stone included?
For products marked “Setting Only”, the centre stone is not included. For finished jewellery, the stone shown in your selected option is included unless the product page states otherwise.
How do I choose the correct ring size?
Use our ring size guide and measure at a comfortable room temperature. For wide bands or unusual designs, contact us before ordering.
Can the ring be resized after purchase?
Many rings can be resized, but the available range depends on the design, metal and stone setting. Full-eternity and certain intricate designs may not be resizable.
Which metals are available?
Available metals and colours are listed in the product selector. The final price updates according to the selected metal and other paid options.
Is a diamond certificate included?
A grading report is included only when it is explicitly stated in the product description or selected option. Please contact us if you require a specific laboratory report.
Are customised or engraved items returnable?
Customised, resized, engraved and made-to-order items may have different exchange or refund conditions. Review the policy before confirming your order.