Men's Rope Two-Tone Band Rings - NM22 - Roselle Jewelry

NM22 - Men's Vintage Rope Two-Tone Gold Wedding Band Ring

$4,188.00 HKD
במלאי הזמנה מראש אזל

צבע קלוע: White Gold + Yellow Gold

White Gold + Yellow Gold
White Gold + Rose Gold
Yellow Gold + Rose Gold
White Gold Only
Yellow Gold Only
Rose Gold Only

מתכת: S925 Silver (Platinum Plated)

S925 Silver (Platinum Plated)
9K Gold
14K Gold
18K Gold
Walk-ins welcome · No appointment needed
Visit our Hong Kong stores to view diamonds and custom pieces, or WhatsApp us for a quick quote.
For rings, one-time resize within ±2 sizes is included after purchase.

Embrace the timeless elegance of the NM22 Men's Rope Wedding Band from Roselle Jewelry. This ring refines the classic rope motif with a touch of vintage sophistication. Featuring a central twisted rope design flanked by contrasting gold rails, the NM22 often incorporates subtle detailing like milgrain (beaded) edges or step profiles that frame the twist like a work of art. The two-tone combination highlights the intricate texture, symbolizing the weaving together of two unique stories into a harmonious whole. It is a ring that speaks of enduring love, patience, and a bond that grows more beautiful with time. Handcrafted in 18K gold.

Product Code NM22
Width(mm) 6.0
Size HK#10 ~ HK#30

american expressapple paygoogle payvisamasterunionpaypaypalfpspaymealipaywechatpayalipay hkshopify paydiscoverdiners club