Men's Rope Two-Tone Band Rings - NM22 - Roselle Jewelry

NM22 - Cincin Perkahwinan Lelaki Vintage Tali Dua Nada Emas

$4,188.00 HKD
Dalam stok Pra pesanan Keluar dari stok

Warna Anyaman: Emas Putih + Emas Kuning

Emas Putih + Emas Kuning
Emas Putih + Emas Mawar
Emas Kuning + Emas Mawar
Hanya Emas Putih
Hanya Emas Kuning
Hanya Emas Mawar

Logam: Perak S925 (Dilatih Platinum)

Perak S925 (Dilatih Platinum)
Emas 9K
Emas 14K
18K Emas
Walk-ins welcome · No appointment needed
Visit our Hong Kong stores to view diamonds and custom pieces, or WhatsApp us for a quick quote.
For rings, one-time resize within ±2 sizes is included after purchase.

Rangkul keanggunan abadi Cincin Perkahwinan Tali Lelaki NM22 dari Roselle Jewelry. Cincin ini memperhalusi motif tali klasik dengan sentuhan keanggunan vintaj. Menampilkan reka bentuk tali berpintal di tengah yang dikelilingi oleh rel emas yang berbeza warna, NM22 sering menggabungkan perincian halus seperti tepi milgrain (berbintik) atau profil bertahap yang membingkai putaran seperti karya seni. Gabungan dua tona menonjolkan tekstur rumit, melambangkan penyatuan dua kisah unik menjadi satu kesatuan yang harmoni. Ia adalah cincin yang melambangkan cinta yang kekal, kesabaran, dan ikatan yang menjadi lebih indah dengan masa. Dihasilkan dengan tangan dalam emas 18K.

Kod Produk NM22
Lebar(mm) 6.0
Saiz HK#10 ~ HK#30

american expressapple paygoogle payvisamasterunionpaypaypalfpspaymealipaywechatpayalipay hkshopify paydiscoverdiners club

Product questions

Is the centre stone included?
For products marked “Setting Only”, the centre stone is not included. For finished jewellery, the stone shown in your selected option is included unless the product page states otherwise.
How do I choose the correct ring size?
Use our ring size guide and measure at a comfortable room temperature. For wide bands or unusual designs, contact us before ordering.
Can the ring be resized after purchase?
Many rings can be resized, but the available range depends on the design, metal and stone setting. Full-eternity and certain intricate designs may not be resizable.
Which metals are available?
Available metals and colours are listed in the product selector. The final price updates according to the selected metal and other paid options.
Is a diamond certificate included?
A grading report is included only when it is explicitly stated in the product description or selected option. Please contact us if you require a specific laboratory report.
Are customised or engraved items returnable?
Customised, resized, engraved and made-to-order items may have different exchange or refund conditions. Review the policy before confirming your order.